PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g52815.1.p
Common NameBRADI_2g52815
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family FAR1
Protein Properties Length: 637aa    MW: 71177.8 Da    PI: 9.9014
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g52815.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR169.86.3e-2212137290
              FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk......................................tekerrtra 56 
                        Yn+YA+ +GFs++ ++s++s  ++ + k++fvC++  k+++ +++                                       +k+rr+++
  Bradi2g52815.1.p  12 HYNAYARVMGFSIKSNTSRRSAYTNLVEKQQFVCNRFRKPKPVDDAagksynptgnssrarrdesssdeehvdapnedpllvrkVVKKRRRES 104
                       6*****************************************99999************************************9999999*** PP

              FAR1  57 etrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                        ++tgCkak++vk+  dg+wev+ ++ +HnHel 
  Bradi2g52815.1.p 105 IKQTGCKAKMTVKLI-DGRWEVIFFVADHNHELI 137
                       ***************.****************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.3E-1912137IPR004330FAR1 DNA binding domain
PROSITE profilePS509668.988347383IPR007527Zinc finger, SWIM-type
PfamPF044346.5E-5353382IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 637 aa     Download sequence    Send to blast
MRFDTLAGAK AHYNAYARVM GFSIKSNTSR RSAYTNLVEK QQFVCNRFRK PKPVDDAAGK  60
SYNPTGNSSR ARRDESSSDE EHVDAPNEDP LLVRKVVKKR RRESIKQTGC KAKMTVKLID  120
GRWEVIFFVA DHNHELITKP SLTKYLLSHK NISLEEETFL RILDDCNLET GQMMTLMSTF  180
YANGFIVPYT TKTISNFRSK IRSERKGDDM AETVSYFMAK QKEDPSFYFN VKLDEDERHQ  240
LEEHADFAHL YNIRRTWVPC YFRDCFFPFL KSTQRSEGFN AVLKRYVNPH NSILNFVKQY  300
EKIQVKILVK EGGNNYMTNH LTQATWSSYP IEKQAFTTYT MTSIRSYLVL ARVGDNEYSC  360
ECGKMKRDRL LCCHILKVFT HLGIDEIPGR YNMRRWTQNA IPREVARPDE TQPDALPPES  420
LKQIRMANLS VKYGELARIS CCSDAANAIA EKYIRVTKTE ITHLNLMRRK DAKRRRETAA  480
REASAASASS APATTHAATP PAPATAPRPA TTSGGAPATT APTPATTAAS TVSGAATVPA  540
PATATSGCAP ATASHRPATT TTCPATATAS AASGATTASA SIDPNRVRNP DRCLTKGRPR  600
AKRYENALEL HPKKKNKCAF CSSDEHNSAR CPWKLA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233530.11e-159PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A0Q3JD630.0A0A0Q3JD63_BRADI; Uncharacterized protein
STRINGBRADI1G10750.11e-160(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP9528843
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-16FAR1-related sequence 5